ARMER Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35720

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARMER Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARMER (NP_055976.1).

Sequence:
MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARMER Antibody - BSA Free

ARMER Antibody

Western Blot: ARMER Antibody [NBP3-35720] -

Western Blot: ARMER Antibody [NBP3-35720] - Western blot analysis of various lysates, using ARMER Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
ARMER Antibody

Immunohistochemistry: ARMER Antibody [NBP3-35720] -

Immunohistochemistry: ARMER Antibody [NBP3-35720] - Immunohistochemistry analysis of ARMER in paraffin-embedded Rat testis tissue using ARMER Rabbit pAb at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer(pH 7.2) prior to IHC staining.
ARMER Antibody

Immunohistochemistry: ARMER Antibody [NBP3-35720] -

Immunohistochemistry: ARMER Antibody [NBP3-35720] - Immunohistochemistry analysis of ARMER in paraffin-embedded Mouse testis tissue using ARMER Rabbit pAb at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer(pH 7.2) prior to IHC staining.

Applications for ARMER Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ARMER

Apoptosis is important for normal development and tissue homeostasis. It is mediated by various caspases and ultimately results in the activation of endogenous endonucleases that degrade cellular DNA. Although apoptosis induced by endoplasmic reticulum (ER) stress is thought to be mediated by caspase-12, other caspases such as caspase-9 are also thought to be activated following ER stress. Recently, ARMER, a novel integral ER-membrane protein was shown to protect cells from ER stress-induced apoptosis. Analysis of the caspase proteolytic cascade suggests that ARMER acts by inhibiting caspase-9 activity (3), although the mechanism for this remains unkown. It should be noted that ARMER is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains.

Alternate Names

ADP-ribosylation factor-like 6 interacting protein, ADP-ribosylation factor-like 6 interacting protein 1, AIP1, Aip-1, apoptotic regulator in the membrane of the endoplasmic reticulum, ARL-6-interacting protein 1, ARL6IPaip-1, ARMER, KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1

Gene Symbol

ARL6IP1

Additional ARMER Products

Product Documents for ARMER Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARMER Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARMER Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARMER Antibody - BSA Free and earn rewards!

Have you used ARMER Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies