ARP10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91682

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, SDS-Page

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARP10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKQS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARP10 Antibody - BSA Free

Western Blot: ARP10 Antibody [NBP1-91682]

Western Blot: ARP10 Antibody [NBP1-91682]

ARP10-Antibody-Western-Blot-NBP1-91682-img0005.jpg
Western Blot: ARP10 Antibody [NBP1-91682]

Western Blot: ARP10 Antibody [NBP1-91682]

Western Blot: ARP10 Antibody [NBP1-91682] - A) APOBEC3H (A3H) haplotype II SV183 and various mutants expressed in 293T cells. B) The Novus anti-ARP10 antibody detected two splice variants of A3H, SV183 and SV200 in MCF-7 cell lysates. Transient transfection, overnight incubation with primary. WB image submitted by a verified customer review.
ARP10 Antibody

Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] -

Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human liver shows no positivity in hepatocytes as expected.
ARP10 Antibody

Western Blot: ARP10 Antibody [NBP1-91682] -

Western Blot: ARP10 Antibody [NBP1-91682] - Generation & validation of HIV-1 Vif separation-of-function molecular/viral probes.A) A schematic of the Vif protein encoded by each HIV-1 molecular clone showing amino acid differences responsible for the hyper- & hypo-Vif functionality relative to lab-Vif (HIV-1 IIIB/NL4-3) against stable A3H haplotype II. B) Immunoblots showing the expression levels of the indicated A3 proteins stably expressed in SupT11 cells. In this experiment untagged A3H is detected with the mouse monoclonal antibody P3A3-A10. C) HIV-1 spreading infection kinetics for the indicated viruses on A3-expressing SupT11 cells lines described in panel B. The hyper-, lab-, & hypo-Vif isolates spread with similar kinetics on cells expressing a control vector, A3D, A3F, or A3G, but showed clear phenotypic differences on cells expressing low, intermediate (int), & high levels of stable A3H haplotype II. Delta-Vif virus replication was evident in control vector expressing SupT11 cells, delayed in A3D expressing cells, & suppressed under all other conditions (some symbols eclipsed). Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pgen.1004761), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ARP10 Antibody - BSA Free Immunohistochemistry: ARP10 Antibody - BSA Free [NBP1-91682]

Immunohistochemistry: ARP10 Antibody - BSA Free [NBP1-91682]

Staining of human liver shows no positivity in hepatocytes as expected.
ARP10 Antibody - BSA Free Immunohistochemistry: ARP10 Antibody - BSA Free [NBP1-91682]

Immunohistochemistry: ARP10 Antibody - BSA Free [NBP1-91682]

Staining of human skin shows no positivity in squamous epithelial cells as expected.
ARP10 Antibody - BSA Free Western Blot: ARP10 Antibody - BSA Free [NBP1-91682]

Western Blot: ARP10 Antibody - BSA Free [NBP1-91682]

Analysis in human cell line HDLM-2 and human cell line RT-4.
ARP10 Antibody - BSA Free Immunohistochemistry: ARP10 Antibody - BSA Free [NBP1-91682]

Immunohistochemistry: ARP10 Antibody - BSA Free [NBP1-91682]

Staining of human pancreas shows strong cytpoplasmic granular positivity in a subset of exocrine glandular cells.
ARP10 Antibody - BSA Free Immunohistochemistry: ARP10 Antibody - BSA Free [NBP1-91682]

Immunohistochemistry: ARP10 Antibody - BSA Free [NBP1-91682]

Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Applications for ARP10 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Reported in scientific literature (PMID 27650891)

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

Reported in scientific literature (PMID: 25411794)/verified customer review.
Application Notes
IHC-Paraffin, HIER pH 6 retrieval method is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP1-91682 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARP10

Members of the APOBEC family of proteins, like APOBEC3H, are mRNA editing enzymes that affect protein diversity by deamination of cytidine to produce uridine (Wedekind et al., 2003 [PubMed 12683974]).[supplied by OMIM]

Alternate Names

APOBEC-related protein 10, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H, ARP-10, ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H, DNA dC->dU-editing enzyme APOBEC-3H, EC 3.5.4.-

Entrez Gene IDs

164668 (Human)

Gene Symbol

APOBEC3H

UniProt

Q6NTF7 (Human)

Additional ARP10 Products

Product Documents for ARP10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARP10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ARP10 Antibody - BSA Free

Customer Reviews for ARP10 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ARP10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • ARP10 Antibody
    Name: Michael Carpenter
    Application: Western Blot
    Sample Tested: 293T and MCF-7 cell lysates
    Species: Human
    Verified Customer | Posted 11/17/2017
    A) APOBEC3H (A3H) haplotype II SV183 and various mutants expressed in 293T cells. B) The Novus anti-ARP10 antibody detected two splice variants of A3H, SV183 and SV200 in MCF-7 cell lysates. Transient transfection, overnight incubation with primary.
    ARP10 Antibody - BSA Free NBP1-91682

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies