Arylsulfatase B/ARSB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86270

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYF

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Arylsulfatase B/ARSB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Arylsulfatase B/ARSB Antibody [NBP1-86270]

Immunocytochemistry/ Immunofluorescence: Arylsulfatase B/ARSB Antibody [NBP1-86270]

Immunocytochemistry/Immunofluorescence: Arylsulfatase B/ARSB Antibody [NBP1-86270] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.
Arylsulfatase B/ARSB Antibody - BSA Free Immunohistochemistry-Paraffin: Arylsulfatase B/ARSB Antibody - BSA Free [NBP1-86270]

Immunohistochemistry-Paraffin: Arylsulfatase B/ARSB Antibody - BSA Free [NBP1-86270]

Staining of human liver shows strong cytoplasmic granular positivity in cytoplasm in hepatocytes.
Arylsulfatase B/ARSB Antibody - BSA Free Immunohistochemistry-Paraffin: Arylsulfatase B/ARSB Antibody - BSA Free [NBP1-86270]

Immunohistochemistry-Paraffin: Arylsulfatase B/ARSB Antibody - BSA Free [NBP1-86270]

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Arylsulfatase B/ARSB Antibody - BSA Free Immunohistochemistry-Paraffin: Arylsulfatase B/ARSB Antibody - BSA Free [NBP1-86270]

Immunohistochemistry-Paraffin: Arylsulfatase B/ARSB Antibody - BSA Free [NBP1-86270]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Arylsulfatase B/ARSB Antibody - BSA Free Immunohistochemistry-Paraffin: Arylsulfatase B/ARSB Antibody - BSA Free [NBP1-86270]

Immunohistochemistry-Paraffin: Arylsulfatase B/ARSB Antibody - BSA Free [NBP1-86270]

Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Applications for Arylsulfatase B/ARSB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Arylsulfatase B/ARSB

Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targetted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

ARSB, ASB, N-acetylgalactosamine-4-sulfatase

Gene Symbol

ARSB

Additional Arylsulfatase B/ARSB Products

Product Documents for Arylsulfatase B/ARSB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Arylsulfatase B/ARSB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Arylsulfatase B/ARSB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Arylsulfatase B/ARSB Antibody - BSA Free and earn rewards!

Have you used Arylsulfatase B/ARSB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...