Ataxin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57735

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ataxin 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVLLKHSKADGLAGSRHRYAEQENGINQGSAQMLSENGELKFPEKMGLPAAPFLTKIEPSKPAATRKRRWSAPESRKLEKSEDEPP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ataxin 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Ataxin 1 Antibody [NBP2-57735]

Immunocytochemistry/ Immunofluorescence: Ataxin 1 Antibody [NBP2-57735]

Immunocytochemistry/Immunofluorescence: Ataxin 1 Antibody [NBP2-57735] - Staining of human cell line RT4 shows localization to nucleoplasm & cytosol.

Applications for Ataxin 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ataxin 1

Defects in Ataxin-1 are the cause of spinocerebellar ataxia type 1 (SCA1), also known as olivopontocerebellar atrophy I (OPCA I or OPCA1). Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to cerebellum degeneration with variable involvement of the brainstem and spinal cord. SCA1 is caused by expansion of a CAG repeat in the coding region of the ataxin-1 gene. Longer expansions result in earlier onset and more severe clinical manifestations of the disease. Ataxin-1 binds RNA in vitro and may be involved in RNA metabolism. [Uniprot]

Alternate Names

ataxin 1, ataxin 1), ataxin-1, ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant, SCA1D6S504E, Spinocerebellar ataxia type 1 protein

Gene Symbol

ATXN1

Additional Ataxin 1 Products

Product Documents for Ataxin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ataxin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ataxin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ataxin 1 Antibody - BSA Free and earn rewards!

Have you used Ataxin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies