ATP5A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38470

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATP5A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP5A Antibody - BSA Free

Western Blot: ATP5A Antibody [NBP2-38470]

Western Blot: ATP5A Antibody [NBP2-38470]

Western Blot: ATP5A Antibody [NBP2-38470] - Analysis using Anti-ATP5A1 antibody NBP2-38470 (A) shows similar pattern to independent antibody NBP2-38525 (B).
Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470] - Staining of human colon.
Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470] - Staining of human colon, heart muscle, kidney and liver using Anti-ATP5A1 antibody NBP2-38470 (A) shows similar protein distribution across tissues to independent antibody NBP2-38525 (B).
Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470] - Staining of human liver.
Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470] - Staining of human kidney.
Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470]

Immunohistochemistry-Paraffin: ATP5A Antibody [NBP2-38470] - Staining of human heart muscle.

Applications for ATP5A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP5A

ATP5A encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the same protein have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16. [provided by RefSeq]

Long Name

ATP5A1

Alternate Names

ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 co, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2, ATP sythase (F1-ATPase) alpha subunit, ATP5A, ATP5A1, ATP5AL2, ATP5AMOM2, ATPM, ATPMATP synthase subunit alpha, mitochondrial, cardiac muscle, COXPD22, EC 3.6.3, EC 3.6.3.14, epididymis secretory sperm binding protein Li 123m, hATP1, HEL-S-123m, MC5DN4, MC5DN4A, MC5DN4B, mitochondrial ATP synthetase, oligomycin-resistant, MOM2, OMR, ORM, ORMATP synthase alpha chain, mitochondrial

Gene Symbol

ATP5F1A

UniProt

P25705 (Human)

Additional ATP5A Products

Product Documents for ATP5A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP5A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP5A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP5A Antibody - BSA Free and earn rewards!

Have you used ATP5A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies