ATP5A Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-92928
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ATP5A1 (NP_004037.1). MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for ATP5A Antibody - BSA Free
Simple Western: ATP5A Antibody [NBP2-92928] -
Simple Western: ATP5A Antibody [NBP2-92928] - ATP5A Antibodies (NBP2-92928), ProteinSimple Western Blot on Jess Instrument. One microgram of human brain tissue lysate was tested with the antibodies diluted 1:10 or 1:20 times. Image from verified customer review.Western Blot: ATP5A AntibodyBSA Free [NBP2-92928]
Western Blot: ATP5A Antibody [NBP2-92928] - Analysis of extracts of various cell lines, using ATP5A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] -
Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] - Confocal immunofluorescence analysis of Hela cells using ATP5A Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] -
Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] - Confocal immunofluorescence analysis of U-2OS cells using ATP5A Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.Applications for ATP5A Antibody - BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:5000
Application Notes
See Simple Western Antibody Database for Simple Western validation
Reviewed Applications
Read 1 review rated 5 using NBP2-92928 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: ATP5A
Long Name
ATP5A1
Alternate Names
ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 co, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2, ATP sythase (F1-ATPase) alpha subunit, ATP5A, ATP5A1, ATP5AL2, ATP5AMOM2, ATPM, ATPMATP synthase subunit alpha, mitochondrial, cardiac muscle, COXPD22, EC 3.6.3, EC 3.6.3.14, epididymis secretory sperm binding protein Li 123m, hATP1, HEL-S-123m, MC5DN4, MC5DN4A, MC5DN4B, mitochondrial ATP synthetase, oligomycin-resistant, MOM2, OMR, ORM, ORMATP synthase alpha chain, mitochondrial
Gene Symbol
ATP5F1A
Additional ATP5A Products
Product Documents for ATP5A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ATP5A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ATP5A Antibody - BSA Free
Customer Reviews for ATP5A Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used ATP5A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Simple WesternSample Tested: human brain lysateSpecies: HumanVerified Customer | Posted 04/06/2023ATP5A Antibodies NBP2-92928, ProteinSimple Western Blot on Jess Instrument. One microgram of human brain tissue lysate was tested with the antibodies diluted 1:10 or 1:20 times.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...