ATP5G2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35291

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATP5G2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ATP5G2 (NP_001002031.1).

Sequence:
ATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATP5G2 Antibody - BSA Free

ATP5G2 Antibody

Immunocytochemistry/ Immunofluorescence: ATP5G2 Antibody [NBP3-35291] -

Immunocytochemistry/ Immunofluorescence: ATP5G2 Antibody [NBP3-35291] - Immunofluorescence analysis of L929 cells using ATP5G2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ATP5G2 Antibody

Western Blot: ATP5G2 Antibody [NBP3-35291] -

Western Blot: ATP5G2 Antibody [NBP3-35291] - Western blot analysis of various lysates using ATP5G2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for ATP5G2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATP5G2

The ATP5G2 gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis,utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATPsynthase is composed of two linke

Alternate Names

ATP synthase lipid-binding protein, mitochondrial, ATP synthase proteolipid P2, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9), ATPase protein 9, ATPase subunit c, isoform 2, mitochondrial ATP synthase, subunit C (subunit 9)

Gene Symbol

ATP5G2

Additional ATP5G2 Products

Product Documents for ATP5G2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP5G2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP5G2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP5G2 Antibody - BSA Free and earn rewards!

Have you used ATP5G2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies