ATP6V0D2 Antibody (7A4) - Azide and BSA Free

Novus Biologicals | Catalog # H00245972-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Validated:

Western Blot, ELISA, Sandwich ELISA

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 7A4

Format

Azide and BSA Free
View all ATP6V0D2 Primary Antibodies »

Product Specifications

Immunogen

ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN

Reactivity Notes

Human. Other species not tested.

Specificity

ATP6V0D2 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for ATP6V0D2 Antibody (7A4) - Azide and BSA Free

Sandwich ELISA: ATP6V0D2 Antibody (7A4) [H00245972-M01] - Detection limit for recombinant GST tagged ATP6V0D2 is 0.03 ng/ml as a capture antibody.

Applications for ATP6V0D2 Antibody (7A4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ATP6V0D2

ATP6V0D2 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2

Alternate Names

ATP6D2, ATP6V0, ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2, FLJ38708, Vacuolar proton pump subunit d 2, V-ATPase subunit d 2, VMA6, V-type proton ATPase subunit d 2

Entrez Gene IDs

245972 (Human)

Gene Symbol

ATP6V0D2

UniProt

NP_689778 (Human)

Additional ATP6V0D2 Products

Product Documents for ATP6V0D2 Antibody (7A4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP6V0D2 Antibody (7A4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ATP6V0D2 Antibody (7A4) - Azide and BSA Free

Customer Reviews for ATP6V0D2 Antibody (7A4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ATP6V0D2 Antibody (7A4) - Azide and BSA Free and earn rewards!

Have you used ATP6V0D2 Antibody (7A4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies