ATP6V1C2 Antibody (3D5) - Azide and BSA Free

Novus Biologicals | Catalog # H00245973-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 3D5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

ATP6V1C2 (NP_653184, 188 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD

Reactivity Notes

Human. Other species not tested.

Specificity

ATP6V1C2 - ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for ATP6V1C2 Antibody (3D5) - Azide and BSA Free

Western Blot: ATP6V1C2 Antibody (3D5) [H00245973-M01]

Western Blot: ATP6V1C2 Antibody (3D5) [H00245973-M01]

Western Blot: ATP6V1C2 Antibody (3D5) [H00245973-M01] - ATP6V1C2 monoclonal antibody (M01), clone 3D5 Analysis of ATP6V1C2 expression in HeLa.
Sandwich ELISA: ATP6V1C2 Antibody (3D5) [H00245973-M01] - Detection limit for recombinant GST tagged ATP6V1C2 is approximately 0.03ng/ml as a capture antibody.

Applications for ATP6V1C2 Antibody (3D5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ATP6V1C2

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A,three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms.

Alternate Names

ATP6C2, ATPase, H+ transporting, lysosomal 42kD, V1 subunit C isoform 2, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2, Vacuolar proton pump subunit C 2, V-ATPase C2 subunit, V-ATPase subunit C 2, VMA5, V-type proton ATPase subunit C 2

Entrez Gene IDs

245973 (Human)

Gene Symbol

ATP6V1C2

Additional ATP6V1C2 Products

Product Documents for ATP6V1C2 Antibody (3D5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V1C2 Antibody (3D5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP6V1C2 Antibody (3D5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ATP6V1C2 Antibody (3D5) - Azide and BSA Free and earn rewards!

Have you used ATP6V1C2 Antibody (3D5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...