Recombinant Human ATP6V1G3 GST (N-Term) Protein

Novus Biologicals | Catalog # H00127124-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-118 of Human ATP6V1G3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

40.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ATP6V1G3 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00127124-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: ATP6V1G3

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3, H+ transporting, lysosomal (vacuolar proton pump) subunit G3, MGC119810, MGC119813, vacuolar ATP synthase subunit G 3, vacuolar proton pump G subunit 3, Vacuolar proton pump subunit G 3, vacuolar proton pump, subunit G3, V-ATPase 13 kDa subunit 3, V-ATPase G subunit 3, V-ATPase G3 subunit, V-ATPase subunit G 3, V-type proton ATPase subunit G 3

Gene Symbol

ATP6V1G3

Additional ATP6V1G3 Products

Product Documents for Recombinant Human ATP6V1G3 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human ATP6V1G3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human ATP6V1G3 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human ATP6V1G3 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human ATP6V1G3 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...