ATPase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89709

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATPase Antibody - BSA Free

ATPase Antibody - BSA Free Immunohistochemistry-Paraffin: ATPase Antibody - BSA Free [NBP1-89709]

Immunohistochemistry-Paraffin: ATPase Antibody - BSA Free [NBP1-89709]

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
ATPase Antibody - BSA Free Immunohistochemistry-Paraffin: ATPase Antibody - BSA Free [NBP1-89709]

Immunohistochemistry-Paraffin: ATPase Antibody - BSA Free [NBP1-89709]

Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
ATPase Antibody - BSA Free Immunohistochemistry-Paraffin: ATPase Antibody - BSA Free [NBP1-89709]

Immunohistochemistry-Paraffin: ATPase Antibody - BSA Free [NBP1-89709]

Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
ATPase Antibody - BSA Free Immunohistochemistry-Paraffin: ATPase Antibody - BSA Free [NBP1-89709]

Immunohistochemistry-Paraffin: ATPase Antibody - BSA Free [NBP1-89709]

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Applications for ATPase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATPase

CATALYTIC ACTIVITY: ATP + H2O = ADP + phosphate. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein (By similarity). ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. SIMILARITY: Belongs to the cation transport ATPase (P-type) family. Type V subfamily.

Alternate Names

ATPase, axonemal, dynein, axonemal, heavy chain 8, dynein, axonemal, heavy polypeptide 8, FLJ25850, FLJ36115, FLJ36334, HDHC9

Gene Symbol

DNAH8

Additional ATPase Products

Product Documents for ATPase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATPase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for ATPase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATPase Antibody - BSA Free and earn rewards!

Have you used ATPase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATPase Antibody - BSA Free

Showing  1 - 4 of 4 FAQs Showing All
  • Q: I have phosphate in my enzyme. What can I do?

    A: You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.

  • Q: I have 5% DMSO in my assay. Can I use PiColorLock Gold?

    A: Yes, the reagent is designed for drug screening work and other situations that require DMSO.

  • Q: I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample

    A: This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.

  • Q: I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?

    A: Yes, only the phosphate will give a signal; pyrophosphate will not.

  • Q: I have phosphate in my enzyme. What can I do?

    A: You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.

  • Q: I have 5% DMSO in my assay. Can I use PiColorLock Gold?

    A: Yes, the reagent is designed for drug screening work and other situations that require DMSO.

  • Q: I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample

    A: This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.

  • Q: I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?

    A: Yes, only the phosphate will give a signal; pyrophosphate will not.

  • Q: I have phosphate in my enzyme. What can I do?

    A: You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.

  • Q: I have 5% DMSO in my assay. Can I use PiColorLock Gold?

    A: Yes, the reagent is designed for drug screening work and other situations that require DMSO.

  • Q: I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample

    A: This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.

  • Q: I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?

    A: Yes, only the phosphate will give a signal; pyrophosphate will not.

  • Q: I have phosphate in my enzyme. What can I do?

    A: You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.

  • Q: I have 5% DMSO in my assay. Can I use PiColorLock Gold?

    A: Yes, the reagent is designed for drug screening work and other situations that require DMSO.

  • Q: I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample

    A: This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.

  • Q: I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?

    A: Yes, only the phosphate will give a signal; pyrophosphate will not.

Showing  1 - 4 of 4 FAQs Showing All
View all FAQs for Antibodies
Loading...