BDH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55042

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BDH1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEK

Reactivity Notes

Mouse 88%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BDH1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: BDH1 Antibody [NBP2-55042]

Immunocytochemistry/ Immunofluorescence: BDH1 Antibody [NBP2-55042]

Immunocytochemistry/Immunofluorescence: BDH1 Antibody [NBP2-55042] - Staining of human cell line MCF7 shows localization to mitochondria.

Applications for BDH1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BDH1

BDH1 encodes a member of the short-chain dehydrogenase/reductase gene family. The encoded protein forms a homotetrameric lipid-requiring enzyme of the mitochondrial membrane and has a specific requirement for phosphatidylcholine for optimal enzymatic activity. The encoded protein catalyzes the interconversion of acetoacetate and (R)-3-hydroxybutyrate, the two major ketone bodies produced during fatty acid catabolism. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq]

Alternate Names

(R)-3-hydroxybutyrate dehydrogenase, 3-hydroxybutyrate dehydrogenase, 3-hydroxybutyrate dehydrogenase, type 1, EC 1.1.1, MGC2723, MGC4347, MGC9788, mitochondrial, mitochondrial), short chain dehydrogenase/reductase family 9C, member 1

Gene Symbol

BDH1

Additional BDH1 Products

Product Documents for BDH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BDH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BDH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BDH1 Antibody - BSA Free and earn rewards!

Have you used BDH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies