Bestrophin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92985

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Bestrophin 1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 171-270 of human Bestrophin 1 (NP_004174.1). LEKLSLPHNMFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Bestrophin 1 Antibody - BSA Free

Western Blot: Bestrophin 1 AntibodyBSA Free [NBP2-92985]

Western Blot: Bestrophin 1 AntibodyBSA Free [NBP2-92985]

Western Blot: Bestrophin 1 Antibody [NBP2-92985] - Analysis of extracts of various cell lines, using Bestrophin 1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Applications for Bestrophin 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Bestrophin 1

Bestrophin 1 (BEST1) is a member of the bestrophin family of anion channels. Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. Bestrophins are believed to function as chloride channels.

Bestrophin-1, also known as best macular dystrophy (BMD) or vitelliform macular dystrophy (VMD2), is an inherited autosomal form of macular degeneration, characterized by a depressed light peak in the electrooculogram (EOG). Bestrophin 1 is a 68 kDa basolateral plasma membrane protein encoded by the VMD2 gene. Bestrophin 1's function is still unknown, but data suggests that it is a chloride channel that plays a role in generating the altered EOG in Best disease patients. In addition, Bestrophin-1 is a useful biochemical and histological marker of RPE (retinal pigment epithelial cells) cells.

Bestrophin antibodies are useful tools for studies involving vision and retinal disease. .

Alternate Names

ARB, BEST, Best disease, bestrophin 1, bestrophin-1, BMD, TU15B, vitelliform macular dystrophy 2, Vitelliform macular dystrophy protein 2, VMD2RP50

Gene Symbol

BEST1

Additional Bestrophin 1 Products

Product Documents for Bestrophin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Bestrophin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Bestrophin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Bestrophin 1 Antibody - BSA Free and earn rewards!

Have you used Bestrophin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies