Recombinant Human Beta Hydroxysteroid Dehydrogenase GST (N-Term) Protein

Novus Biologicals | Catalog # H00003284-P01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE
View all Beta Hydroxysteroid Dehydrogenase Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-372 of Human HSD3B2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

68.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images

SDS-PAGE: Recombinant Human Beta Hydroxysteroid Dehydrogenase GST (N-Term) Protein [H00003284-P01]

SDS-PAGE: Recombinant Human Beta Hydroxysteroid Dehydrogenase GST (N-Term) Protein [H00003284-P01]

SDS-Page: Recombinant Human Beta Hydroxysteroid Dehydrogenase Protein [H00003284-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00003284-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Beta Hydroxysteroid Dehydrogenase

The protein encoded by the Beta Hydroxysteroid Dehydrogenases gene is a bifunctional enzyme that catalyzes the oxidative conversion ofdelta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in thebiosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads.Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternativelyspliced transcript variants have been found for this gene. (provided by RefSeq)

Alternate Names

3 beta-HSD type II, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, 3-beta-HSD II, delta 5-delta 4-isomerase type II, HSD3B, HSDB, HSDB3B, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2,3-beta-hydroxy-Delta(5)-steroid dehydrogenase, progesterone reductase, SDR11E2, short chain dehydrogenase/reductase family 11E, member 2,3-beta-hydroxy-5-ene steroid dehydrogenase

Gene Symbol

HSD3B2

Additional Beta Hydroxysteroid Dehydrogenase Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews

There are currently no reviews for this product. Be the first to review Recombinant Human Beta Hydroxysteroid Dehydrogenase GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Beta Hydroxysteroid Dehydrogenase GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes