beta-Synuclein Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90342

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for beta-Synuclein Antibody - BSA Free

beta-Synuclein Antibody - BSA Free Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Analysis in human cerebral cortex and liver tissues using NBP1-90342 antibody. Corresponding SNCB RNA-seq data are presented for the same tissues.
beta-Synuclein Antibody - BSA Free Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
beta-Synuclein Antibody - BSA Free Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Staining of human liver shows no positivity in hepatocytes as expected.
beta-Synuclein Antibody - BSA Free Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Staining of human rectum shows no positivity in glandular cells as expected.
beta-Synuclein Antibody - BSA Free Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Immunohistochemistry: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Staining of human prostate shows no positivity in glandular cells as expected.
beta-Synuclein Antibody - BSA Free Western Blot: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Western Blot: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Analysis in control (vector only transfected HEK293T lysate) and SNCB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
beta-Synuclein Antibody - BSA Free Western Blot: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Western Blot: beta-Synuclein Antibody - BSA Free [NBP1-90342]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Mouse Cerebral Cortex tissue

Applications for beta-Synuclein Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta-Synuclein

Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function (1).

Alternate Names

SNCB, Synuclein-beta

Gene Symbol

SNCB

Additional beta-Synuclein Products

Product Documents for beta-Synuclein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for beta-Synuclein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for beta-Synuclein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review beta-Synuclein Antibody - BSA Free and earn rewards!

Have you used beta-Synuclein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...