BHMT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55288

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat, Fish

Cited:

Fish

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BHMT Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to BHMT(betaine-homocysteine methyltransferase) The peptide sequence was selected from the N terminal of BHMT. Peptide sequence AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Use in Oryzias latipes reported in secitific publication PMID: 32437540

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for BHMT Antibody - BSA Free

Western Blot: BHMT Antibody [NBP1-55288]

Western Blot: BHMT Antibody [NBP1-55288]

Western Blot: BHMT Antibody [NBP1-55288] - Lanes: Lane1: 20 ug rat liver lysate Primary Antibody Dilution: 1:2000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:15000 Gene Name: BHMT Submitted by: Anonymous
Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-55288]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-55288]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-55288] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: BHMT Antibody [NBP1-55288]

Western Blot: BHMT Antibody [NBP1-55288]

Western Blot: BHMT Antibody [NBP1-55288] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.
Western Blot: BHMT Antibody [NBP1-55288]

Western Blot: BHMT Antibody [NBP1-55288]

Western Blot: BHMT Antibody [NBP1-55288] - Lanes: Lane1 : 20 ug rat liver lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1 : 15000 Gene name: BHMT Submitted by: Anonymous.
Western Blot: BHMT Antibody [NBP1-55288]

Western Blot: BHMT Antibody [NBP1-55288]

Western Blot: BHMT Antibody [NBP1-55288] - Reccomended Titration: 2.5 ug/ml Positive Control: Human Fetal Liver cell lysate

Applications for BHMT Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BHMT

BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.Betaine-homocysteine methyltransferase is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in BHMT could lead to hyperhomocyst(e)inemia,but such a defect has not yet been observed.

Alternate Names

betaine homocysteine methyltransferase, betaine-homocysteine methyltransferase, betaine--homocysteine S-methyltransferase, betaine--homocysteine S-methyltransferase 1, BHMT1, EC 2.1.1, EC 2.1.1.5

Gene Symbol

BHMT

UniProt

Q93088 (Human)

Additional BHMT Products

Product Documents for BHMT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BHMT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for BHMT Antibody - BSA Free

Customer Reviews for BHMT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BHMT Antibody - BSA Free and earn rewards!

Have you used BHMT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies