BHMT Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38850

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BHMT Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BHMT Antibody - BSA Free

Western Blot: BHMT Antibody [NBP2-38850]

Western Blot: BHMT Antibody [NBP2-38850]

Western Blot: BHMT Antibody [NBP2-38850] - Analysis using Anti-BHMT antibody NBP2-38850 (A) shows similar pattern to independent antibody NBP1-88611 (B).
Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850] - Staining of human cerebral cortex.
Western Blot: BHMT Antibody [NBP2-38850]

Western Blot: BHMT Antibody [NBP2-38850]

Western Blot: BHMT Antibody [NBP2-38850] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850] - Staining in human kidney and lymph node tissues using anti-BHMT antibody. Corresponding BHMT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850] - Staining of human cerebral cortex, colon, kidney and testis using Anti-BHMT antibody NBP2-38850 (A) shows similar protein distribution across tissues to independent antibody NBP1-88611 (B).
Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850] - Staining of human colon.
Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850] - Staining of human testis.
Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850]

Immunohistochemistry-Paraffin: BHMT Antibody [NBP2-38850] - Staining of human kidney using Anti-BHMT antibody NBP2-38850.

Applications for BHMT Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BHMT

BHMT encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. [provided by RefSeq]

Alternate Names

betaine homocysteine methyltransferase, betaine-homocysteine methyltransferase, betaine--homocysteine S-methyltransferase, betaine--homocysteine S-methyltransferase 1, BHMT1, EC 2.1.1, EC 2.1.1.5

Gene Symbol

BHMT

UniProt

Q93088 (Human)

Additional BHMT Products

Product Documents for BHMT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BHMT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BHMT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BHMT Antibody - BSA Free and earn rewards!

Have you used BHMT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies