BIN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48690

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EKPVRTPEAKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISADSSEGQDQLQVSMVPENNNLTAPEPQEEVSTSENPQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BIN2 Antibody - BSA Free

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining in human bone marrow and pancreas tissues using anti-BIN2 antibody. Corresponding BIN2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human bone marrow, liver, lymph node and pancreas using Anti-BIN2 antibody NBP2-48690 (A) shows similar protein distribution across tissues to independent antibody NBP2-48691 (B).
Western Blot: BIN2 Antibody [NBP2-48690]

Western Blot: BIN2 Antibody [NBP2-48690]

Western Blot: BIN2 Antibody [NBP2-48690] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human liver.
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]

Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human lymph node.
BIN2 Antibody - BSA Free

Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -

phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BIN2 Antibody - BSA Free

Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -

phyA and phyB interact with BIN2. (A,B) His pull-down assays showing the interactions of phyA-N, phyA-C (A), phyB-N and phyB-C (B) with BIN2. GST-BIN2 served as a bait. His-TF-phyA-N, His-TF-phyA-C, His-TF-phyB-N, His-TF-phyB-C, and His-TF served as preys. The preys were detected with alpha -His antibody. (C,D) Split-LUC assays showing the interactions of phyA (C) and phyB (D) with BIN2. The vectors expressing nLUC and/or cLUC served as negative controls. (E,F) Semi-in vivo GST pull-down assays showing far-red and red light-dependent interactions of phyA (E) and phyB (F) with BIN2, respectively. GST-BIN2 served as a bait. The protein extracts prepared from phyA-YFP-OX and Myc-phyB-OX seedlings served as preys. phyA-YFP-OX and Myc-phyB-OX seedlings were grown in dark for 5 days, and then exposed to far-red light (FR, 10 μmol/m2/s) and red light (R, 50 μmol/m2/s) for 30 min, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BIN2 Antibody - BSA Free

Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -

phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BIN2 Antibody - BSA Free

Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -

phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BIN2 Antibody - BSA Free

Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -

phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BIN2 Antibody - BSA Free

Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -

phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BIN2 Antibody - BSA Free

Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -

phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BIN2 Antibody - BSA Free

Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -

phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for BIN2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BIN2

Alternate Names

BRAP1, BRAP-1, breast cancer associated protein BRAP1, Breast cancer-associated protein 1, bridging integrator 2, bridging integrator-2

Gene Symbol

BIN2

Additional BIN2 Products

Product Documents for BIN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BIN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BIN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BIN2 Antibody - BSA Free and earn rewards!

Have you used BIN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...