BPTF/FALZ Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57567

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BPTF/FALZ Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: BPTF/FALZ Antibody [NBP2-57567]

Immunocytochemistry/ Immunofluorescence: BPTF/FALZ Antibody [NBP2-57567]

Immunocytochemistry/Immunofluorescence: BPTF/FALZ Antibody [NBP2-57567] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Applications for BPTF/FALZ Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BPTF/FALZ

FALZ/BPTF is a histone-binding component of NURF (nucleosome remodeling factor), a complex that catalyzes ATP-dependent nucleosome sliding and facilitates transcription of chromatin. This gene was identified in brain homogenates from patients with Alzheimer's disease. Analysis of the original protein (fetal Alz-50 reactive clone 1, or FAC1), containing a DNA-binding domain, a zinc finger motif, and a C-terminal bromodomain, suggested it might play a role in the regulation of transcription during proliferation. High levels of FAC1 were detected in fetal brain and in patients with neurodegenerative diseases. This protein is highly similar to the largest subunit of the Drosophila NURF (nucleosome remodeling factor) complex.

Long Name

Nucleosome-remodeling factor subunit BPTF

Alternate Names

BPTF, FAC1, FALZ

Gene Symbol

BPTF

Additional BPTF/FALZ Products

Product Documents for BPTF/FALZ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BPTF/FALZ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BPTF/FALZ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BPTF/FALZ Antibody - BSA Free and earn rewards!

Have you used BPTF/FALZ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for BPTF/FALZ Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am interesting by anti-BPTF antibody. I would like to know if a large protein like that could be revealed in PVDF membrane?

    A: Regarding your question, nucleosome-remodeling factor subunit (BPTF) is a very large protein as you have also mentioned (338KD). There are some tips for efficient transfer of these proteins in western blot for instance: 1) Make sure to use a low percentage gel, for BPTF in particular I suggest you use 7% gel or even lower (5%). 2) You can use either Nitrocellulose or PVDF, to my knowledge the binding efficiency is higher for nitrocellulose while PVDF is a better choice of membrane if you are planning to do re-probing and stripping. If you are going to use PVDF, make sure to wet it in 100% methanol before use. Furthermore, PVDF membrane exhibits better binding efficiency of electroblotted material in the presence of SDS in the transfer buffer. However SDS added to facilitate transfer of large proteins should not exceed 0.05% as it will interfere with the binding of the protein to the membrane. 3) For transfer you can either use the semi-dry or wet transfer but you decide doing wet transfer, I strongly recommend you doing the transfer in low voltage (at 50v) for instance in order to obtain an efficient transfer. These are some suggestions I can provide for a better and more efficient transfer for large proteins like BPTF.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...