BRCA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62628

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BRCA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit BRCA1 Antibody - BSA Free (NBP2-62628) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for BRCA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP2-62628]

Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP2-62628]

Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP2-62628] - Immunohistochemistry analysis in human testis and pancreas tissues using Anti-BRCA1 antibody. Corresponding BRCA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP2-62628]

Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP2-62628]

Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP2-62628] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP2-62628]

Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP2-62628]

Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP2-62628] - Staining of human pancreas shows low expression as expected.

Applications for BRCA1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRCA1

The BRCA1 gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. BRCA1 is expressed in the cells of breast and other tissue, where it helps to repair double strand DNA breaks and initiate apoptosis in cells with excessive damage. BRCA1 mutations lead to improper DNA repair and eventually to cancer development.

BRCA1 antibodies are useful for cancer studies.

Long Name

Breast Cancer 1

Alternate Names

BRCAI, breast and ovarian cancer susceptibility protein 1, breast and ovarian cancer sususceptibility protein, breast cancer 1, early onset, breast cancer type 1 susceptibility protein, EC 6.3.2, EC 6.3.2.-, IRIS, PNCA4, PSCP, subunit 1

Gene Symbol

BRCA1

Additional BRCA1 Products

Product Documents for BRCA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BRCA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BRCA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRCA1 Antibody - BSA Free and earn rewards!

Have you used BRCA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies