Breast cancer suppressor candidate 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56919

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Breast cancer suppressor candidate 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Breast cancer suppressor candidate 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Breast cancer suppressor candidate 1 Antibody [NBP2-56919]

Immunocytochemistry/ Immunofluorescence: Breast cancer suppressor candidate 1 Antibody [NBP2-56919]

Immunocytochemistry/Immunofluorescence: Breast cancer suppressor candidate 1 Antibody [NBP2-56919] - Staining of human cell line RH-30 shows localization to nucleus.

Applications for Breast cancer suppressor candidate 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Breast cancer suppressor candidate 1

Alternate Names

BCSC-1Loss of heterozygosity 11 chromosomal region 2 gene A protein, BCSC1ortholog of mouse AW551984, Breast cancer suppressor candidate 1, LOH11CR2Avon Willebrand factor A domain-containing protein 5A, loss of heterozygosity, 11, chromosomal region 2, gene A, von Willebrand factor A domain containing 5A

Gene Symbol

VWA5A

Additional Breast cancer suppressor candidate 1 Products

Product Documents for Breast cancer suppressor candidate 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Breast cancer suppressor candidate 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Breast cancer suppressor candidate 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Breast cancer suppressor candidate 1 Antibody - BSA Free and earn rewards!

Have you used Breast cancer suppressor candidate 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies