Brorin/VWC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33745

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Brorin/VWC2 Antibody - BSA Free

Western Blot: Brorin/VWC2 Antibody [NBP2-33745]

Western Blot: Brorin/VWC2 Antibody [NBP2-33745]

Western Blot: Brorin/VWC2 Antibody [NBP2-33745] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745]

Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745]

Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745] - Staining of breast cancer.
Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745]

Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745]

Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745] - Staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745]

Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745]

Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745] - Staining of liver.

Applications for Brorin/VWC2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Brorin/VWC2

Brorin (brain-specific chordin-like protein), also called VWC2, is an ~46 kDa glycoprotein that is a member of the Chordin family of secreted BMP regulators. The human Brorin cDNA encodes 325 amino acids (aa) including a 27 aa signal sequence and a 298 aa secreted mature protein with two VWFC domains. These domains contain a pattern of 10 cysteine residues that is conserved in other family members, with the remaining aa sequence sharing little identity. Human Brorin shares 90%, 91%, and 95% aa sequence identity with mouse, rat, and equine Brorin, respectively. It also shares aa identity with VWC2L (Brorin-like) of 37% overall and 62% within the VWFC domains. Brorin is predominantly expressed in embryonic and adult neural tissues in the mouse. Expression of Brorin mRNA is concentrated in neurons within the diencephalon and medulla oblongata but is not detected in the developing cerebral cortex. Brorin binds and antagonizes BMPs, interacting via the VWFC domains. It promotes neurogenesis in mouse neural precursors. Knockdown of Brorin in zebrafish embryos results in morphological abnormalities in the brain and eye.

Long Name

von Willebrand Factor A2 Domain

Alternate Names

Brain-specific chordin-like protein, VWC2

Gene Symbol

VWC2

UniProt

Additional Brorin/VWC2 Products

Product Documents for Brorin/VWC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Brorin/VWC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Brorin/VWC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Brorin/VWC2 Antibody - BSA Free and earn rewards!

Have you used Brorin/VWC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...