BTAF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38188

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA, Immunoprecipitation, Chromatin Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1600-1849 of human BTAF1 (NP_003963.1).

Sequence:
LAVQNSSLHDIQHAPKLSALKQLLLDCGLGNGSTSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

207 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for BTAF1 Antibody - BSA Free

BTAF1 Antibody

Western Blot: BTAF1 Antibody [NBP3-38188] -

Western Blot: BTAF1 Antibody [NBP3-38188] - Western blot analysis of various lysates using BTAF1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
BTAF1 Antibody

Chromatin Immunoprecipitation: BTAF1 Antibody [NBP3-38188] -

Chromatin Immunoprecipitation: BTAF1 Antibody [NBP3-38188] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using BTAF1 antibody and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
BTAF1 Antibody

Immunoprecipitation: BTAF1 Antibody [NBP3-38188] -

Immunoprecipitation: BTAF1 Antibody [NBP3-38188] - Immunoprecipitation analysis of 150 ug extracts of HeLa cells using 3 ug BTAF1 antibody. Western blot was performed from the immunoprecipitate using BTAF1 antibody at a dilution of 1:500.

Applications for BTAF1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation

5ug antibody for 10ug-15ug of Chromatin

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BTAF1

BTAF1 is a member of the SNF2-like family of ATPases that associates with the TATA-binding protein (TBP) and TAFII170 (TAF172) to form the B-TF-IID complex. As part of the general transcription machinery, BTAF1 acts as a regulator of TBP and RNA polymerase II transcription. Alternate names for BTAF1 include BTAF-1, RNA polymerase II, B-TFIID transcription factor-associated, 170kDa, TAF172, TBP-associated factor 172, TAFII170, B-TFIID transcription factor-associated, 170kDa, and MOT1.

Alternate Names

ATP-dependent helicase BTAF1, BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1homolog, S. cerevisiae), B-TFIID transcription factor-associated 170 kDa subunit, EC 3.6.1, EC 3.6.4.-, MOT1MGC138406, TAF(II)170KIAA0940, TAF-172, TAF172BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170 kD (Mot1homolog, S. cerevisiae), TAFII170TATA-binding protein-associated factor 172, TBP-associated factor 172

Gene Symbol

BTAF1

Additional BTAF1 Products

Product Documents for BTAF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BTAF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BTAF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BTAF1 Antibody - BSA Free and earn rewards!

Have you used BTAF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...