Bub1 Antibody (6U8G10)

Novus Biologicals | Catalog # NBP3-33408

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6U8G10
View all Bub1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Bub1 (NP_004327.1).

Sequence:
MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Bub1 Antibody (6U8G10)

Bub1 Antibody (6U8G10)

Western Blot: Bub1 Antibody (6U8G10) [NBP3-33408] -

Western Blot: Bub1 Antibody (6U8G10) [NBP3-33408] - Western blot analysis of lysates from HEL cells, using [KD Validated] Bub1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Bub1 Antibody (6U8G10)

Western Blot: Bub1 Antibody (6U8G10) [NBP3-33408] -

Western Blot: Bub1 Antibody (6U8G10) [NBP3-33408] - Western blot analysis of lysates from wild type(WT) and Bub1 knockdown (KD) 293T cells, using [KD Validated] Bub1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for Bub1 Antibody (6U8G10)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Bub1

BUB1 encodes a kinase involved in spindle checkpoint function. The kinase functions in part by phosphorylating a member of the miotic checkpoint complex and activating the spindle checkpoint. Mutations in this gene have been associated with aneuploidy and several forms of cancer.

Long Name

BUB1 Budding Uninhibited By Benzimidazoles 1 Homolog

Alternate Names

BUB1 budding uninhibited by benzimidazoles 1 homolog, BUB1Amitotic checkpoint serine/threonine-protein kinase BUB1, BUB1L, budding uninhibited by benzimidazoles 1 (yeast homolog), budding uninhibited by benzimidazoles 1 homolog (yeast), EC 2.7.11.1, hBUB1mitotic spindle checkpoint kinase, putative serine/threonine-protein kinase

Gene Symbol

BUB1

Additional Bub1 Products

Product Documents for Bub1 Antibody (6U8G10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Bub1 Antibody (6U8G10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Bub1 Antibody (6U8G10)

There are currently no reviews for this product. Be the first to review Bub1 Antibody (6U8G10) and earn rewards!

Have you used Bub1 Antibody (6U8G10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies