Recombinant Human Bub1 GST (N-Term) Protein

Name: Recombinant Human Bub1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000699-Q01
Price: 749 USD
Availability: InStock

Novus Biologicals | Catalog # H00000699-Q01

Submit a review

Citations (1)

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Immunohistochemistry, Western Blot, ELISA, Affinity Purification, Microarray

View all Bub1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-130 of Human BUB1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Bub1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Bub1 GST (N-Term) Protein [H00000699-Q01]

SDS-Page: Recombinant Human Bub1 Protein [H00000699-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00000699-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Bub1

BUB1 - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast)

Long Name

BUB1 Budding Uninhibited By Benzimidazoles 1 Homolog

Alternate Names

BUB1 budding uninhibited by benzimidazoles 1 homolog, BUB1Amitotic checkpoint serine/threonine-protein kinase BUB1, BUB1L, budding uninhibited by benzimidazoles 1 (yeast homolog), budding uninhibited by benzimidazoles 1 homolog (yeast), EC 2.7.11.1, hBUB1mitotic spindle checkpoint kinase, putative serine/threonine-protein kinase

Gene Symbol

BUB1

Additional Bub1 Products

Product Documents for Recombinant Human Bub1 GST (N-Term) Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Recombinant Human Bub1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Human Bub1 GST (N-Term) Protein

Customer Reviews for Recombinant Human Bub1 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Bub1 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Bub1 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image