![Western Blot: Bub3 Antibody [NBP1-58206]](https://resources.rndsystems.com/images/products/Bub3-Antibody-Western-Blot-NBP1-58206-img0005.jpg "Western Blot: Bub3 Antibody [NBP1-58206]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to BUB3(BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast)) The peptide sequence was selected from the N terminal of BUB3 (NP_001007794).
Peptide sequence MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Bub3 Antibody - BSA Free
Western Blot: Bub3 Antibody [NBP1-58206]
Western Blot: Bub3 Antibody [NBP1-58206] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml BUB3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.![Immunocytochemistry/ Immunofluorescence: Bub3 Antibody [NBP1-58206]](https://resources.rndsystems.com/images/products/Bub3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-58206-img0004.jpg "Immunocytochemistry/ Immunofluorescence: Bub3 Antibody [NBP1-58206]")
Immunocytochemistry/ Immunofluorescence: Bub3 Antibody [NBP1-58206]
Immunocytochemistry/Immunofluorescence: Bub3 Antibody [NBP1-58206] - HCT116 Primary Antibody Dilution: 4 ug/ml Secondary Antibody : Anti-rabbit Alexa 546 Secondary Antibody Dilution: 2 ug/ml![Immunohistochemistry: Bub3 Antibody [NBP1-58206]](https://resources.rndsystems.com/images/products/Bub3-Antibody-Immunohistochemistry-NBP1-58206-img0006.jpg "Immunohistochemistry: Bub3 Antibody [NBP1-58206]")
Immunohistochemistry: Bub3 Antibody [NBP1-58206]
Immunohistochemistry: Bub3 Antibody [NBP1-58206] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Nucleus Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec![Western Blot: Bub3 Antibody [NBP1-58206]](https://resources.rndsystems.com/images/products/Bub3-Antibody-Western-Blot-NBP1-58206-img0003.jpg "Western Blot: Bub3 Antibody [NBP1-58206]")
Western Blot: Bub3 Antibody [NBP1-58206]
Western Blot: Bub3 Antibody [NBP1-58206] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.Applications for Bub3 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Bub3
Long Name
BUB3 Budding Uninhibited By Benzimidazoles 1 Homolog
Alternate Names
BUB3 (budding uninhibited by benzimidazoles 3, yeast) homolog, BUB3 budding uninhibited by benzimidazoles 3 homolog, BUB3L, budding uninhibited by benomyl, budding uninhibited by benzimidazoles 3 homolog (yeast), hBUB3, mitotic checkpoint component, mitotic checkpoint protein BUB3
Entrez Gene IDs
9184 (Human)
Gene Symbol
BUB3
UniProt
Additional Bub3 Products
Product Documents for Bub3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Bub3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Bub3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Bub3 Antibody - BSA Free and earn rewards!
Have you used Bub3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...