c-Maf Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10481

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human c-Maf (NP_001026974). Peptide sequence MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLI

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for c-Maf Antibody - BSA Free

Western Blot: c-Maf Antibody [NBP3-10481]

Western Blot: c-Maf Antibody [NBP3-10481]

Western Blot: c-Maf Antibody [NBP3-10481] - 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.3 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.

Applications for c-Maf Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: c-Maf

c-Maf is part of the Maf family of transcription factors that possess a conserved basic region and a leucine zipper domain that mediate DNA and protein-protein binding and plays an important role in tissue-specific gene regulation and cell differentiation. c-Maf is a transcriptional activator of interleukin 4 and 10 in T-cells, and is involved in lens fiber cell differentiation. c-Maf translocation has been observed in human multiple myeloma and may be oncogenic.

Long Name

v-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog (Avian)

Alternate Names

CCA4, cMaf, MAF2

Gene Symbol

MAF

Additional c-Maf Products

Product Documents for c-Maf Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for c-Maf Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for c-Maf Antibody - BSA Free

There are currently no reviews for this product. Be the first to review c-Maf Antibody - BSA Free and earn rewards!

Have you used c-Maf Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Th2 Differentiation Pathway Th2 Differentiation Pathway Thumbnail