Recombinant Human c-Maf GST (N-Term) Protein

Name: Recombinant Human c-Maf GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004094-Q01
Price: 749 USD
Availability: InStock

Novus Biologicals | Catalog # H00004094-Q01

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

View all c-Maf Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 304-403 of Human c-Maf

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human c-Maf GST (N-Term) Protein

SDS-PAGE: Recombinant Human c-Maf GST (N-Term) Protein [H00004094-Q01]

SDS-Page: Recombinant Human c-Maf Protein [H00004094-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00004094-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: c-Maf

MAF - v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian)

Long Name

v-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog (Avian)

Alternate Names

CCA4, cMaf, MAF2

Gene Symbol

MAF

Additional c-Maf Products

Product Documents for Recombinant Human c-Maf GST (N-Term) Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Recombinant Human c-Maf GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.