CABP7 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92722

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all CABP7 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1). PKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CABP7 Antibody - Azide and BSA Free

Western Blot: CABP7 AntibodyAzide and BSA Free [NBP2-92722]

Western Blot: CABP7 AntibodyAzide and BSA Free [NBP2-92722]

Western Blot: CABP7 Antibody [NBP2-92722] - Analysis of extracts of various cell lines, using CABP7 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: CABP7 Antibody - Azide and BSA Free [NBP2-92722]

Immunohistochemistry-Paraffin: CABP7 Antibody - Azide and BSA Free [NBP2-92722]

Immunohistochemistry-Paraffin: CABP7 Antibody [NBP2-92722] - Mouse testis using CABP7 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CABP7 Antibody - Azide and BSA Free [NBP2-92722]

Immunohistochemistry-Paraffin: CABP7 Antibody - Azide and BSA Free [NBP2-92722]

Immunohistochemistry-Paraffin: CABP7 Antibody [NBP2-92722] - Human breast cancer using CABP7 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CABP7 Antibody - Azide and BSA Free [NBP2-92722]

Immunohistochemistry-Paraffin: CABP7 Antibody - Azide and BSA Free [NBP2-92722]

Immunohistochemistry-Paraffin: CABP7 Antibody [NBP2-92722] - Human stomach using CABP7 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol..
Immunohistochemistry-Paraffin: CABP7 Antibody - Azide and BSA Free [NBP2-92722]

Immunohistochemistry-Paraffin: CABP7 Antibody - Azide and BSA Free [NBP2-92722]

Immunohistochemistry-Paraffin: CABP7 Antibody [NBP2-92722] - Mouse kidney using CABP7 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for CABP7 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunohistochemistry

1:50-1:100

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CABP7

Negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting itsactivity

Alternate Names

CaBP7, calcium binding protein 7, calcium-binding protein 7, CALN2, calneuron 2, Calneuron II, calneuron-2, MGC57793

Gene Symbol

CABP7

Additional CABP7 Products

Product Documents for CABP7 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CABP7 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for CABP7 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CABP7 Antibody - Azide and BSA Free and earn rewards!

Have you used CABP7 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies