CACNB3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35459

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 355-484 of human CACNB3 (NP_000716.2).

Sequence:
VYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CACNB3 Antibody - BSA Free

CACNB3 Antibody

Western Blot: CACNB3 Antibody [NBP3-35459] -

Western Blot: CACNB3 Antibody [NBP3-35459] - Western blot analysis of various lysates using CACNB3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.

Applications for CACNB3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CACNB3

The CACNB3 gene encodes for a proteins that are long voltage dependent L-type calcium channel subunit beta-3 gene that aids in regulating surface expression, calcium transport, regulation of transcription factors, and gating of calcium channels. Isoform 3A is 484 amino acids in length with a mass of around 54 kDA while isoform 3B is 447 amino acids long at around 50 kDA. Increasingly, research has investigated the role of the CACNB3 gene in various diseases such as neuronitis, neuropathy, canavan disease, and lambert-eaton myasthenic syndrome. This gene plays a role in many pathways such as CREB transcription, the Celecoxib pathway, MAPK signaling pathway, and the Myometrial Relaxation and Contraction pathways and is known to interact with various other genes such as: CACNA1C, CACNA1B, SYT1, FASLG, and YWHAB.

Alternate Names

CAB3, CACNLB3, Calcium channel voltage-dependent subunit beta 3, calcium channel, voltage-dependent, beta 3 subunit, voltage-dependent L-type calcium channel subunit beta-3

Gene Symbol

CACNB3

Additional CACNB3 Products

Product Documents for CACNB3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CACNB3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CACNB3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CACNB3 Antibody - BSA Free and earn rewards!

Have you used CACNB3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...