CaMKK alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88208

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (96%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CaMKK alpha Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids:KSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CaMKK alpha Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CaMKK alpha Antibody [NBP1-88208]

Immunocytochemistry/ Immunofluorescence: CaMKK alpha Antibody [NBP1-88208]

Immunocytochemistry/Immunofluorescence: CaMKK alpha Antibody [NBP1-88208] - CaMKK Antibody [NBP1-88208] - Staining of human cell line U-251MG shows positivity in cytoplasm. Antibody staining shown in green.
CaMKK alpha Antibody - BSA Free Western Blot: CaMKK alpha Antibody - BSA Free [NBP1-88208]

Western Blot: CaMKK alpha Antibody - BSA Free [NBP1-88208]

Analysis in control (vector only transfected HEK293T lysate) and CAMKK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for CaMKK alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CaMKK alpha

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade. Three transcript variants encoding two distinct isoforms have been identified for this gene.

Long Name

Calcium/Calmodulin-dependent Protein Kinase Kinase alpha

Alternate Names

CaM-kinase IV kinase, CaMKK1

Gene Symbol

CAMKK1

Additional CaMKK alpha Products

Product Documents for CaMKK alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CaMKK alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CaMKK alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CaMKK alpha Antibody - BSA Free and earn rewards!

Have you used CaMKK alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

MAPK Signaling: Oxidative Stress Pathway MAPK Signaling: Oxidative Stress Pathway Thumbnail