Recombinant Human Cannabinoid R1/CB1/CNR1 Protein

Novus Biologicals | Catalog # H00001268-G01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Applications

Western Blot, Affinity Purification
View all Cannabinoid R1/CB1/CNR1 Proteins and Enzymes »

Product Specifications

Description

An untagged recombinant protein corresponding to the amino acid sequence of (NP_057167.2) for Human Cannabinoid R1/CB1/CNR1

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

52.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation, and Storage

H00001268-G01
Preparation Method in vitro wheat germ expression system with proprietary liposome technology
Formulation 25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative Glycerol
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Cannabinoid R1/CB1/CNR1

CB1 Cannabinoid receptor is associated with the regulation of cognition, memory, and motor activity. The CB1 receptor mediates cannabinoid-induced CNS effects and the addictive behavior experienced by users of marijuana. Three splice variants that are produced by alternative splicing have been identified for this gene. CB1 has been reported primarily in the brain and, to a lower extent, in peripheral tissues including adrenal, heart, lung, prostate, uterus, ovary, testis, bone marrow, thymus, and tonsil. ESTs have been isolated from brain, embryo, heart/melanocyte/uterus, lung, placenta, testis, tonsil, and vessel libraries.

Long Name

Cannabinoid Receptor 1

Alternate Names

CANN6, CannabinoidR1, CB-R, CB1, CB1A, CB1K5, CB1R, CNR1, SKR6R

Gene Symbol

CNR1

Additional Cannabinoid R1/CB1/CNR1 Products

Product Documents for Recombinant Human Cannabinoid R1/CB1/CNR1 Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Cannabinoid R1/CB1/CNR1 Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Human Cannabinoid R1/CB1/CNR1 Protein

Customer Reviews for Recombinant Human Cannabinoid R1/CB1/CNR1 Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Cannabinoid R1/CB1/CNR1 Protein and earn rewards!

Have you used Recombinant Human Cannabinoid R1/CB1/CNR1 Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes