CAR/NR1I3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54935

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to NR1I3(nuclear receptor subfamily 1, group I, member 3) The peptide sequence was selected from the middle region of NR1I3 (NP_001070939). Peptide sequence PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CAR/NR1I3 Antibody - BSA Free

Western Blot: CAR/NR1I3 Antibody [NBP1-54935]

Western Blot: CAR/NR1I3 Antibody [NBP1-54935]

Western Blot: CAR/NR1I3 Antibody [NBP1-54935] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: CAR/NR1I3 Antibody [NBP1-54935]

Immunohistochemistry-Paraffin: CAR/NR1I3 Antibody [NBP1-54935]

Immunohistochemistry-Paraffin: CAR/NR1I3 Antibody [NBP1-54935] - Human Colon Tissue, antibody concentration 5 ug/ml.

Applications for CAR/NR1I3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

5 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CAR/NR1I3

NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses. This gene encodes a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members. Unlike most nuclear receptors, this transcriptional regulator is constitutively active in the absence of ligand but is regulated by both agonists and inverse agonists. Ligand binding results in translocation of this protein to the nucleus, where it activates or represses target gene transcription. These ligands include bilirubin, a variety of foreign compounds, steroid hormones, and prescription drugs. Multiple transcript variants encoding different isoforms have been found for this gene.

Long Name

Constitutive Androstane Receptor

Alternate Names

MB67, NR1I3

Entrez Gene IDs

9970 (Human)

Gene Symbol

NR1I3

UniProt

Additional CAR/NR1I3 Products

Product Documents for CAR/NR1I3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CAR/NR1I3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CAR/NR1I3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CAR/NR1I3 Antibody - BSA Free and earn rewards!

Have you used CAR/NR1I3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...