Carnosine Dipeptidase 1/CNDP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17005

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Carnosine Dipeptidase 1/CNDP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carnosine Dipeptidase 1/CNDP1 Antibody - BSA Free

Western Blot: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005]

Western Blot: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005]

Western Blot: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunohistochemistry-Paraffin: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005]

Immunohistochemistry-Paraffin: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005]

Immunohistochemistry-Paraffin: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005] - Staining of human fallopian tube shows low expression as expected.
Immunohistochemistry-Paraffin: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005]

Immunohistochemistry-Paraffin: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005]

Immunohistochemistry-Paraffin: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005]

Immunohistochemistry-Paraffin: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005]

Immunohistochemistry-Paraffin: Carnosine Dipeptidase 1/CNDP1 Antibody [NBP3-17005] - Analysis in human cerebral cortex and fallopian tube tissues using Anti-CNDP1 antibody. Corresponding CNDP1 RNA-seq data are presented for the same tissues.

Applications for Carnosine Dipeptidase 1/CNDP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carnosine Dipeptidase 1/CNDP1

CNDP1 encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region. [provided by RefSeq]

Alternate Names

Carnosinase 1, CNDP1, CPGL2

Gene Symbol

CNDP1

Additional Carnosine Dipeptidase 1/CNDP1 Products

Product Documents for Carnosine Dipeptidase 1/CNDP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Carnosine Dipeptidase 1/CNDP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for Carnosine Dipeptidase 1/CNDP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carnosine Dipeptidase 1/CNDP1 Antibody - BSA Free and earn rewards!

Have you used Carnosine Dipeptidase 1/CNDP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies