Casein Kinase 1 gamma 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38411

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Casein Kinase 1 gamma 2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 316-415 of human Casein Kinase 1 gamma 2 (NP_001310.3).

Sequence:
FDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Casein Kinase 1 gamma 2 Antibody - BSA Free

Casein Kinase 1 gamma 2 Antibody

Western Blot: Casein Kinase 1 gamma 2 Antibody [NBP3-38411] -

Western Blot: Casein Kinase 1 gamma 2 Antibody [NBP3-38411] - Western blot analysis of various lysates using Casein Kinase 1 gamma 2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for Casein Kinase 1 gamma 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Casein Kinase 1 gamma 2

Casein kinase 1 gamma 2 (CSNK1G2) is a serine/threonine protein kinase which shows preferential utilization of acidic proteins such as caseins as a substrate. It can phosphorylate a large number of proteins.

Long Name

Casein kinase I isoform gamma-2

Alternate Names

CK1G2, CKI-gamma 2, CSNK1G2

Gene Symbol

CSNK1G2

Additional Casein Kinase 1 gamma 2 Products

Product Documents for Casein Kinase 1 gamma 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Casein Kinase 1 gamma 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Casein Kinase 1 gamma 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Casein Kinase 1 gamma 2 Antibody - BSA Free and earn rewards!

Have you used Casein Kinase 1 gamma 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies