Casein Kinase 1 gamma Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80262

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of mouse CSNK1G1. Peptide sequence CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Casein Kinase 1 gamma Antibody - BSA Free

Western Blot: Casein Kinase 1 gamma Antibody [NBP1-80262]

Western Blot: Casein Kinase 1 gamma Antibody [NBP1-80262]

Western Blot: Casein Kinase 1 gamma Antibody [NBP1-80262] - Titration: 5.0ug/ml, Positive Control: SP2/0 cell lysate.

Applications for Casein Kinase 1 gamma Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Casein Kinase 1 gamma

Casein kinase I (also designated CKI) and casein kinase II (also designated CKII) compose a family of serine/ threonine protein kinases which are present in all eukaryotes examined to date. CKI family members, which include CKIalpha, gamma, episilon and delta, have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. CKII is usually expressed as a tetrameric complex consisting of either an alpha2beta2 or an alphaalpha'beta2 structure. The alpha catalytic subunit is stimulated by the beta regulatory subunit, which undergoes autophosphorylation. CKII activity is high in the cytosol and nucleus of proliferating and differentiating cells. CKII is known to phosphorylate more than 100 different substrates including nuclear oncoproteins, transcription factors and enzymes involved in DNA metabolism.

Alternate Names

CSNK1G1

Gene Symbol

CSNK1G1

Additional Casein Kinase 1 gamma Products

Product Documents for Casein Kinase 1 gamma Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Casein Kinase 1 gamma Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Casein Kinase 1 gamma Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Casein Kinase 1 gamma Antibody - BSA Free and earn rewards!

Have you used Casein Kinase 1 gamma Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies