Caspase-4 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-05650
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse Caspase-4 (NP_031635.2). FLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGNSGEMWIRESSKPQLCRGVDLPRNMEADAVKLSHVEKDFIAFY
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Caspase-4 Antibody - Azide and BSA Free
Western Blot: Caspase-4 AntibodyAzide and BSA Free [NBP3-05650]
Western Blot: Caspase-4 Antibody [NBP3-05650] - Analysis of extracts of HeLa cells, using Caspase-4 antibody (NBP3-05650) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Western Blot: Caspase-4 AntibodyAzide and BSA Free [NBP3-05650]
Western Blot: Caspase-4 Antibody [NBP3-05650] - Analysis of extracts of Mouse lung, using Caspase-4 antibody (NBP3-05650) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Western Blot: Caspase-4 Antibody - Azide and BSA Free [Caspase-4] -
Western Blot: Caspase-4 Antibody - Azide and BSA Free [Caspase-4] - Western blot analysis of lysates from HEL cells, using Caspase-4 Rabbit pAb at 1:700 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 120s.
Western Blot: Caspase-4 Antibody - Azide and BSA Free [Caspase-4] -
Western Blot: Caspase-4 Antibody - Azide and BSA Free [Caspase-4] - Western blot analysis of lysates from RAW 264.7 cells, using Caspase-4 Rabbit pAb at 1:700 dilution. Raw 264. 7 cells were treated by LPS (1 ug/ml) at 37C for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 120s.
Applications for Caspase-4 Antibody - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:100 - 1:500
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Caspase-4
Alternate Names
CASP4, Caspase4, ICE(rel)II, ICH-2, Mih1/TX, TX
Gene Symbol
CASP4
Additional Caspase-4 Products
Product Documents for Caspase-4 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Caspase-4 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Caspase-4 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review Caspase-4 Antibody - Azide and BSA Free and earn rewards!
Have you used Caspase-4 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...