Caspase-4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05650

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse Caspase-4 (NP_031635.2). FLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGNSGEMWIRESSKPQLCRGVDLPRNMEADAVKLSHVEKDFIAFY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Caspase-4 Antibody - Azide and BSA Free

Western Blot: Caspase-4 AntibodyAzide and BSA Free [NBP3-05650]

Western Blot: Caspase-4 AntibodyAzide and BSA Free [NBP3-05650]

Western Blot: Caspase-4 Antibody [NBP3-05650] - Analysis of extracts of HeLa cells, using Caspase-4 antibody (NBP3-05650) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: Caspase-4 AntibodyAzide and BSA Free [NBP3-05650]

Western Blot: Caspase-4 AntibodyAzide and BSA Free [NBP3-05650]

Western Blot: Caspase-4 Antibody [NBP3-05650] - Analysis of extracts of Mouse lung, using Caspase-4 antibody (NBP3-05650) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Caspase-4 Antibody - Azide and BSA Free

Western Blot: Caspase-4 Antibody - Azide and BSA Free [Caspase-4] -

Western Blot: Caspase-4 Antibody - Azide and BSA Free [Caspase-4] - Western blot analysis of lysates from HEL cells, using Caspase-4 Rabbit pAb at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 120s.
Caspase-4 Antibody - Azide and BSA Free

Western Blot: Caspase-4 Antibody - Azide and BSA Free [Caspase-4] -

Western Blot: Caspase-4 Antibody - Azide and BSA Free [Caspase-4] - Western blot analysis of lysates from RAW 264.7 cells, using Caspase-4 Rabbit pAb at 1:700 dilution. Raw 264. 7 cells were treated by LPS (1 ug/ml) at 37C for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 120s.

Applications for Caspase-4 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Caspase-4

Caspase 4 encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.

Alternate Names

CASP4, Caspase4, ICE(rel)II, ICH-2, Mih1/TX, TX

Gene Symbol

CASP4

Additional Caspase-4 Products

Product Documents for Caspase-4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Caspase-4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Caspase-4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Caspase-4 Antibody - Azide and BSA Free and earn rewards!

Have you used Caspase-4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...