Caspase 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69200

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Flow Cytometry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CASP5 (caspase 5, apoptosis-related cysteine peptidase) The peptide sequence was selected form the middle region of CASP5. Peptide sequence VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Caspase 5 Antibody - BSA Free

Western Blot: Caspase 5 Antibody [NBP1-69200]

Western Blot: Caspase 5 Antibody [NBP1-69200]

Western Blot: Caspase 5 Antibody [NBP1-69200] - A549 cell lysate, concentration 0.2-1 ug/ml.

Applications for Caspase 5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Caspase-5

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene.

Alternate Names

CASP5, Caspase5, ICE(rel)III, Protease ICH-3, Protease TY

Gene Symbol

CASP5

OMIM

NP_001129581 (Human)

Additional Caspase-5 Products

Product Documents for Caspase 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Caspase 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Caspase 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Caspase 5 Antibody - BSA Free and earn rewards!

Have you used Caspase 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

NOD-like Receptor Signaling Pathways
NOD-like Receptor Signaling Pathway Thumbnail