CAT1 Antibody (2B9) - Azide and BSA Free
Novus Biologicals | Catalog # H00006541-M02
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, ELISA, Sandwich ELISA
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 2B9
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
SLC7A1 (NP_003036, 431 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS
Reactivity Notes
Mouse data from journals.plos.org/plosone/article?id=10.1371/journal.pone.0170456.
Specificity
Reacts with solute carrier family 7 (cationic amino acid transporter, y+ system), member 1.
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for CAT1 Antibody (2B9) - Azide and BSA Free
Western Blot: CAT1 Antibody (2B9) [H00006541-M02]
CAT1-Antibody-2B9-Western-Blot-H00006541-M02-img0003.jpgWestern Blot: CAT1 Antibody (2B9) [H00006541-M02]
Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - Analysis of SLC7A1 expression in transfected 293T cell line by SLC7A1 monoclonal antibody (M02), clone 2B9.Lane 1: SLC7A1 transfected lysate (Predicted MW: 67.6 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: CAT1 Antibody (2B9) [H00006541-M02] - Detection limit for recombinant GST tagged SLC7A1 is 0.03 ng/ml as a capture antibody.
Western Blot: CAT1 Antibody (2B9) [H00006541-M02] -
Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - A, Since miRNA214 is upregulated & miRNA 378 is downregulated following 12 days of TAC, western immunoblotting was carried out for nodal molecule (NF kappa B) & other network molecules (HDGF, BCL2 & SLC7A1). GAPDH was used a loading control, *p<0.05 vs. Sham, (n = 8). B, HL-1 cardiomyocyte cells were transfected with allstar scrambled control (Vec), or miRNA 214 along with miRNA 378 or miRNA 214 along with antagomir for miRNA 378. The cells were lysed & subjected to immunoblotting for NF kappa B. GAPDH was used as loading control. *p<0.05 vs. Vec (scrambled vector control transfected cells); **p<0.05 vs. miRNA 214 & 378 transfected cells (n = 3). C, HEK 293 cells were transfected with Vec or miRNA 214 along with miRNA 378 or miRNA 214 along with antagomir for miRNA 378. The cell lysates were subjected to immunoblotting for NF kappa B. GAPDH was used as loading control. *p<0.05 vs. Vec; **p<0.05 vs. miRNA 214 & 378 transfected cells (n = 3). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28329018), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for CAT1 Antibody (2B9) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Sandwich ELISA
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: CAT1/SLC7A1
Long Name
Cationic 1/Solute Carrier Family 7 Member 1
Alternate Names
ATRC1, HCAT1, REC1L, SLC7A1
Entrez Gene IDs
6541 (Human)
Gene Symbol
SLC7A1
UniProt
Additional CAT1/SLC7A1 Products
Product Documents for CAT1 Antibody (2B9) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CAT1 Antibody (2B9) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CAT1 Antibody (2B9) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review CAT1 Antibody (2B9) - Azide and BSA Free and earn rewards!
Have you used CAT1 Antibody (2B9) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...