CAT1 Antibody (2B9) - Azide and BSA Free

Novus Biologicals | Catalog # H00006541-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2B9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SLC7A1 (NP_003036, 431 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS

Reactivity Notes

Mouse data from journals.plos.org/plosone/article?id=10.1371/journal.pone.0170456.

Specificity

Reacts with solute carrier family 7 (cationic amino acid transporter, y+ system), member 1.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for CAT1 Antibody (2B9) - Azide and BSA Free

Western Blot: CAT1 Antibody (2B9) [H00006541-M02]

Western Blot: CAT1 Antibody (2B9) [H00006541-M02]

CAT1-Antibody-2B9-Western-Blot-H00006541-M02-img0003.jpg
Western Blot: CAT1 Antibody (2B9) [H00006541-M02]

Western Blot: CAT1 Antibody (2B9) [H00006541-M02]

Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - Analysis of SLC7A1 expression in transfected 293T cell line by SLC7A1 monoclonal antibody (M02), clone 2B9.Lane 1: SLC7A1 transfected lysate (Predicted MW: 67.6 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: CAT1 Antibody (2B9) [H00006541-M02] - Detection limit for recombinant GST tagged SLC7A1 is 0.03 ng/ml as a capture antibody.
CAT1 Antibody (2B9)

Western Blot: CAT1 Antibody (2B9) [H00006541-M02] -

Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - A, Since miRNA214 is upregulated & miRNA 378 is downregulated following 12 days of TAC, western immunoblotting was carried out for nodal molecule (NF kappa B) & other network molecules (HDGF, BCL2 & SLC7A1). GAPDH was used a loading control, *p<0.05 vs. Sham, (n = 8). B, HL-1 cardiomyocyte cells were transfected with allstar scrambled control (Vec), or miRNA 214 along with miRNA 378 or miRNA 214 along with antagomir for miRNA 378. The cells were lysed & subjected to immunoblotting for NF kappa B. GAPDH was used as loading control. *p<0.05 vs. Vec (scrambled vector control transfected cells); **p<0.05 vs. miRNA 214 & 378 transfected cells (n = 3). C, HEK 293 cells were transfected with Vec or miRNA 214 along with miRNA 378 or miRNA 214 along with antagomir for miRNA 378. The cell lysates were subjected to immunoblotting for NF kappa B. GAPDH was used as loading control. *p<0.05 vs. Vec; **p<0.05 vs. miRNA 214 & 378 transfected cells (n = 3). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28329018), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CAT1 Antibody (2B9) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CAT1/SLC7A1

High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor

Long Name

Cationic 1/Solute Carrier Family 7 Member 1

Alternate Names

ATRC1, HCAT1, REC1L, SLC7A1

Entrez Gene IDs

6541 (Human)

Gene Symbol

SLC7A1

UniProt

Additional CAT1/SLC7A1 Products

Product Documents for CAT1 Antibody (2B9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CAT1 Antibody (2B9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CAT1 Antibody (2B9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CAT1 Antibody (2B9) - Azide and BSA Free and earn rewards!

Have you used CAT1 Antibody (2B9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...