Cathepsin C/DPPI Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10659

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Cathepsin C/DPPI Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Cathepsin C/DPPI. Peptide sequence VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cathepsin C/DPPI Antibody - BSA Free

Immunohistochemistry-Paraffin: Cathepsin C/DPPI Antibody [NBP3-10659]

Immunohistochemistry-Paraffin: Cathepsin C/DPPI Antibody [NBP3-10659]

Immunohistochemistry-Paraffin: Cathepsin C/DPPI Antibody [NBP3-10659] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human heart tissue.

Applications for Cathepsin C/DPPI Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cathepsin C/DPPI

DPP1 is encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in immune/inflammatory cells. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor, and a residual portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

CTSC, DPPI, PALS, PLS

Gene Symbol

CTSC

Additional Cathepsin C/DPPI Products

Product Documents for Cathepsin C/DPPI Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cathepsin C/DPPI Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cathepsin C/DPPI Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cathepsin C/DPPI Antibody - BSA Free and earn rewards!

Have you used Cathepsin C/DPPI Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies