Cathepsin G Antibody (2S2U10)

Novus Biologicals | Catalog # NBP3-33320

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 2S2U10
View all Cathepsin G Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 156-255 of human Cathepsin G (NP_001902.1).

Sequence:
TDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cathepsin G Antibody (2S2U10)

Cathepsin G Antibody (2S2U10)

Western Blot: Cathepsin G Antibody (2S2U10) [NBP3-33320] -

Western Blot: Cathepsin G Antibody (2S2U10) [NBP3-33320] - Western blot analysis of various lysates, using Cathepsin G Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Cathepsin G Antibody (2S2U10)

Western Blot: Cathepsin G Antibody (2S2U10) [NBP3-33320] -

Western Blot: Cathepsin G Antibody (2S2U10) [NBP3-33320] - Western blot analysis of lysates from THP-1 cells, using Cathepsin G Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for Cathepsin G Antibody (2S2U10)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cathepsin G

Cathepsin G is encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. Transcript variants utilizing alternative polyadenylation signals exist for this gene.

Alternate Names

cathepsin G, CathepsinG, CGCATG, EC 3.4.21, EC 3.4.21.20, MGC23078

Gene Symbol

CTSG

Additional Cathepsin G Products

Product Documents for Cathepsin G Antibody (2S2U10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cathepsin G Antibody (2S2U10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cathepsin G Antibody (2S2U10)

There are currently no reviews for this product. Be the first to review Cathepsin G Antibody (2S2U10) and earn rewards!

Have you used Cathepsin G Antibody (2S2U10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies