Caveolin-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54737

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Caveolin-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a Recombinant Protein corresponding to amino acids: LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Caveolin-1 Antibody - BSA Free

Western Blot: Caveolin-1 Antibody [NBP2-54737]

Western Blot: Caveolin-1 Antibody [NBP2-54737]

Western Blot: Caveolin-1 Antibody [NBP2-54737] - Analysis in human cell line A-431 and human cell line CACO-2.
Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737] - Analysis in human lung and pancreas tissues. Corresponding CAV1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737] - Staining of human liver shows moderate membranous positivity in hepatic sinusoid cells.
Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737] - Staining of human placenta shows strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737] - Staining of human lung shows strong membranous positivity in pneumocytes.

Applications for Caveolin-1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Caveolin-1

Caveolae are specialized domains of the plasma membrane that are implicated in the sequestration of a variety of lipid and protein molecules. It has been suggested that these important cellular organelles have a pivotal role in such diverse biochemical processes as lipid metabolism, growth regulation, signal transduction, and apoptosis. Caveolin interacts with and regulates heterotrimeric G-proteins. Currently, there are three members of the caveolin multigene family which are known to encode 21-24 kDa integral membrane proteins that comprise the major structural component of the caveolar membrane in vivo. Caveolin-2 protein is abundantly expressed in fibroblasts and differentiated adipocytes, smooth and skeletal muscle, and endothelial cells. The expression of caveolin-1 is similar to that of caveolin-2 while caveolin-3 expression appears to be limited to muscle tissue types.

Alternate Names

CAV1, Caveolin1, MSTP085, VIP21

Gene Symbol

CAV1

Additional Caveolin-1 Products

Product Documents for Caveolin-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Caveolin-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Caveolin-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Caveolin-1 Antibody - BSA Free and earn rewards!

Have you used Caveolin-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies