CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free

Novus Biologicals | Catalog # H00009541-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2E11

Format

Azide and BSA Free
View all CBF1-interacting corepressor Primary Antibodies »

Product Specifications

Immunogen

CIR (NP_004873, 136 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEG

Specificity

Reacts with CBF1 interacting corepressor.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free

Western Blot: CBF1-interacting corepressor Antibody (2E11) [H00009541-M01]

Western Blot: CBF1-interacting corepressor Antibody (2E11) [H00009541-M01]

Western Blot: CBF1-interacting corepressor Antibody (2E11) [H00009541-M01] - CIR monoclonal antibody (M01), clone 2E11. Analysis of CIR expression in HeLa.
Sandwich ELISA: CBF1-interacting corepressor Antibody (2E11) [H00009541-M01] - Detection limit for recombinant GST tagged CIR is 0.03 ng/ml as a capture antibody.

Applications for CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CBF1-interacting corepressor

Alternate Names

CBF1 interacting corepressor, CBF1-interacting corepressor, CIRrecepin, corepressor interacting with RBPJ 1, corepressor interacting with RBPJ, 1, Recepin

Entrez Gene IDs

9541 (Human)

Gene Symbol

CIR1

UniProt

NP_004873 (Human)

Additional CBF1-interacting corepressor Products

Product Documents for CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free and earn rewards!

Have you used CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies