CCDC114 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-93863
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SKDDQHLLQEQQQKVLQQRMDKVHSEAERLEARFQDVRGQLEKLKADIQLLFTKAHCDSSMIDDLLGVKTSMGDRDMGLFLSLIEKRLVE
Reactivity Notes
Mouse reactivity reported in (PMID: 25192045).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CCDC114 Antibody - BSA Free
Immunohistochemistry-Paraffin: CCDC114 Antibody [NBP1-93863]
Immunohistochemistry-Paraffin: CCDC114 Antibody [NBP1-93863] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.Immunohistochemistry-Paraffin: CCDC114 Antibody [NBP1-93863]
Immunohistochemistry-Paraffin: CCDC114 Antibody [NBP1-93863] - Staining of human bronchus shows strong positivity in cilia in respiratory epithelial cells.Immunohistochemistry-Paraffin: CCDC114 Antibody [NBP1-93863]
Immunohistochemistry-Paraffin: CCDC114 Antibody [NBP1-93863] - Staining of human cerebral cortex shows no positivity in neurons as expected.Immunocytochemistry/ Immunofluorescence: CCDC114 Antibody - BSA Free [NBP1-93863] -
The ODAD1 mutation (c.71-2A > C; c.598-2A > C) led to the absence of wild-type ODAD1 and the defects of the outer dynein arm in ciliary axonemes and caused a decrease in ciliary beat frequency. (A) Diagram of ODAD1 demonstrating the antigenic site of the antibody used (red box) and the location of the mutation (arrow) in the patient. Yellow boxes represent predicted coiled-coil domains, and blue boxes represent disordered domains. (B) In control individuals, ODAD1 was localized along the length of the axoneme in ciliated cells. (C) In patient Ⅲ:1, the expression of ODAD1 was significantly low. Green, acetylated-alpha -tubulin; red, ODAD1; blue, DAPI. Scale bar = 20 μm. (D) Ultrastructure of the ciliary axonemes of the patient and control individuals was analyzed via TEM; defects in the ODA of ciliary axonemes were observed in the patient. While many ciliary cross-sections did not show ODA, some sections exhibited ODAs. The white asterisks indicate the structure of ODAs (scale bar = 100 nm). (E) CBF is significantly lower in the patient than in control individuals (***, p < 0.001). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38028630), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for CCDC114 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
Reactivity reported in (PMID: 25192045)
Immunohistochemistry
1:5000 - 1:10000
Immunohistochemistry-Paraffin
1:5000 - 1:10000
Immunoprecipitation
Reactivity reported in (PMID: 25192045)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CCDC114
Alternate Names
coiled-coil domain containing 114, FLJ32926
Gene Symbol
ODAD1
Additional CCDC114 Products
Product Documents for CCDC114 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CCDC114 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CCDC114 Antibody - BSA Free
Customer Reviews for CCDC114 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CCDC114 Antibody - BSA Free and earn rewards!
Have you used CCDC114 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...