CCT6A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-46686

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CCT6A Antibody - BSA Free

Western Blot: CCT6A Antibody [NBP2-46686]

Western Blot: CCT6A Antibody [NBP2-46686]

Western Blot: CCT6A Antibody [NBP2-46686] - Analysis in human cell lines A-431 and MCF-7 using anti-CCT6A antibody. Corresponding CCT6A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: CCT6A Antibody [NBP2-46686]

Western Blot: CCT6A Antibody [NBP2-46686]

Western Blot: CCT6A Antibody [NBP2-46686] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: CCT6A Antibody [NBP2-46686]

Immunohistochemistry-Paraffin: CCT6A Antibody [NBP2-46686]

Immunohistochemistry-Paraffin: CCT6A Antibody [NBP2-46686] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Western Blot: CCT6A Antibody [NBP2-46686]

Western Blot: CCT6A Antibody [NBP2-46686]

Western Blot: CCT6A Antibody [NBP2-46686] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG

Applications for CCT6A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCT6A

The CCT6A gene encodes a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known asthe TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight differentproteins. Unfolded poly

Alternate Names

acute morphine dependence related protein 2, Acute morphine dependence-related protein 2, amino acid transport defect-complementing, CCT6, CCTZ, CCT-zeta, CCT-zeta-1, chaperonin containing T-complex subunit 6, chaperonin containing TCP1, subunit 6A (zeta 1), histidine transport regulator 3, HTR3MGC126215, MGC126214, MoDP-2, T-complex protein 1 subunit zeta, T-complex protein 1, zeta subunit, TCP-1-zeta, TCP20, TCPZ, TTCP20

Entrez Gene IDs

908 (Human)

Gene Symbol

CCT6A

UniProt

Additional CCT6A Products

Product Documents for CCT6A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CCT6A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCT6A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCT6A Antibody - BSA Free and earn rewards!

Have you used CCT6A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...