CD3 epsilon Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38520

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CD3 epsilon Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CD3 epsilon Antibody - BSA Free (NBP2-38520) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CD3 epsilon Antibody - BSA Free

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human cerebral cortex, lymph node, spleen and tonsil using Anti-CD3E antibody NBP2-38520 (A) shows similar protein distribution across tissues to independent antibody NBP2-38479 (B).
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining in human lymph node and pancreas tissues. Corresponding CD3E RNA-seq data are presented for the same tissues.
Western Blot: CD3 epsilon Antibody [NBP2-38520]

Western Blot: CD3 epsilon Antibody [NBP2-38520]

Western Blot: CD3 epsilon Antibody [NBP2-38520] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human granular layer of the cerebellum shows no cytoplasmic positivity as expected.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520]

Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human tonsil.

Applications for CD3 epsilon Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD3 epsilon

CD3 epsilon is a subunit of CD3. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits: CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkinje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.

Alternate Names

CD3e

Gene Symbol

CD3E

UniProt

P07766

Additional CD3 epsilon Products

Product Documents for CD3 epsilon Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD3 epsilon Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD3 epsilon Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD3 epsilon Antibody - BSA Free and earn rewards!

Have you used CD3 epsilon Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies