CD3 gamma Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32636

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CD3 gamma Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD3 gamma Antibody - BSA Free

Simple Western: CD3 gamma Antibody [NBP2-32636]

Simple Western: CD3 gamma Antibody [NBP2-32636]

Simple Western: CD3 gamma Antibody [NBP2-32636] - Simple Western lane view shows a specific band for CD3G in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining in human lymph node and small intestine tissues. Corresponding CD3G RNA-seq data are presented for the same tissues.
Western Blot: CD3 gamma Antibody [NBP2-32636]

Western Blot: CD3 gamma Antibody [NBP2-32636]

Western Blot: CD3 gamma Antibody [NBP2-32636] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human granular layer of the cerebellum shows no cytoplasmic positivity as expected.
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human lymph node shows moderate to strong positivity.
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human small intestine shows moderate to strong positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636]

Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human spleen shows moderate to strong positivity.
Simple Western: CD3 gamma Antibody [NBP2-32636]

Simple Western: CD3 gamma Antibody [NBP2-32636]

Simple Western: CD3 gamma Antibody [NBP2-32636] - Electropherogram image of the corresponding Simple Western lane view. CD3G antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.

Applications for CD3 gamma Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:25

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in MOLT-4 lysate(s), separated by Size, antibody dilution of 1:25, apparent MW was 42 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD3 gamma

CD3G is encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.

Alternate Names

CD3g, IMD17, T3G

Gene Symbol

CD3G

Additional CD3 gamma Products

Product Documents for CD3 gamma Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD3 gamma Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD3 gamma Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD3 gamma Antibody - BSA Free and earn rewards!

Have you used CD3 gamma Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies