CD40 Ligand/TNFSF5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-16982

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CD40 Ligand/TNFSF5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CD40 Ligand/TNFSF5 Antibody - BSA Free (NBP3-16982) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CD40 Ligand/TNFSF5 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP3-16982]

Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP3-16982]

Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP3-16982] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP3-16982]

Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP3-16982]

Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP3-16982] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP3-16982]

Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP3-16982]

Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP3-16982] - Analysis in human lymph node and cerebral cortex tissues using Anti-CD40LG antibody. Corresponding CD40LG RNA-seq data are presented for the same tissues.

Applications for CD40 Ligand/TNFSF5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD40 Ligand/TNFSF5

CD40L is the ligand for CD40, a member of the tumor necrosis factor (TNF) receptor superfamily. CD40L is expressed mainly on activated CD4+ T-lymphocytes as a single-pass type II membrane protein. Proteolytic processing of the membrane form results in a soluble secreted form of CD40L.

Alternate Names

CD154, CD40L, CD40LG, gp39, TNFSF5, TRAP

Gene Symbol

CD40LG

Additional CD40 Ligand/TNFSF5 Products

Product Documents for CD40 Ligand/TNFSF5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD40 Ligand/TNFSF5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD40 Ligand/TNFSF5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD40 Ligand/TNFSF5 Antibody - BSA Free and earn rewards!

Have you used CD40 Ligand/TNFSF5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD40 Ligand/TNFSF5 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

    • Q: I am looking for paired ABs for use in detecting CD40L (rat) by ELISA. Do you have such a reagent(s) available?
      A: Unfortunately we currently do not have any CD40 Ligand antibody pairs that have been validated in Rat. The only antibody pairs we offer for CD40L are validated in Human. I apologize for this inconvenience. If you would be interested in testing one of our products in Rat I'd like to invite you to participate in our Innovators Reward Program. Please contact us at innovators@novusbio.com with any questions regarding this program.
Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies