CD83 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38485

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEET

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD83 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining in human tonsil and endometrium tissues. Corresponding CD83 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: CD83 Antibody [NBP2-38485]

Immunocytochemistry/ Immunofluorescence: CD83 Antibody [NBP2-38485]

Immunocytochemistry/Immunofluorescence: CD83 Antibody [NBP2-38485] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining of human colon shows moderate positivity in nuclear membrane in lymphoid cells.
Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining of human endometrium shows moderate positivity in nuclear membrane in lymphoid cells.
Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining of human lung shows moderate membranous positivity in macrophages.
Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485]

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining of human tonsil shows moderate positivity in nuclear membrane in lymphoid cells.

Applications for CD83 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD83

CD83 is a 43 kD single chain type I glycoprotein also known as HB15. A member of the immunoglobulin superfamily, CD83 is expressed on a subset of dendritic cells, Langerhans cells, and weakly on activated lymphocytes. Although CD83 is thought to play a role in antigen presentation and/or lymphocyte activation, the precise function of this protein is unknown. CD83 is considered to be a useful marker for mature dendritic cells.

Alternate Names

BL11, CD83, HB15

Gene Symbol

CD83

UniProt

Additional CD83 Products

Product Documents for CD83 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD83 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD83 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD83 Antibody - BSA Free and earn rewards!

Have you used CD83 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies