CDC42EP4 Antibody (3G10) - Azide and BSA Free

Novus Biologicals | Catalog # H00023580-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 3G10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CDC42EP4 (NP_036253, 163 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIM

Specificity

CDC42EP4 - CDC42 effector protein (Rho GTPase binding) 4 (3G10)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for CDC42EP4 Antibody (3G10) - Azide and BSA Free

Western Blot: CDC42EP4 Antibody (3G10) [H00023580-M05]

Western Blot: CDC42EP4 Antibody (3G10) [H00023580-M05]

Western Blot: CDC42EP4 Antibody (3G10) [H00023580-M05] - Analysis of CDC42EP4 expression in transfected 293T cell line by CDC42EP4 monoclonal antibody (M05), clone 3G10. Lane 1: CDC42EP4 transfected lysate (Predicted MW: 38 KDa). Lane 2: Non-transfected lysate.

Applications for CDC42EP4 Antibody (3G10) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CDC42EP4

The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. [provided by RefSeq]

Alternate Names

BORG4MGC3740, CDC42 effector protein (Rho GTPase binding) 4, cdc42 effector protein 4, CEP4Binder of Rho GTPases 4, KAIA1777, MGC17125

Entrez Gene IDs

23580 (Human)

Gene Symbol

CDC42EP4

Additional CDC42EP4 Products

Product Documents for CDC42EP4 Antibody (3G10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDC42EP4 Antibody (3G10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDC42EP4 Antibody (3G10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CDC42EP4 Antibody (3G10) - Azide and BSA Free and earn rewards!

Have you used CDC42EP4 Antibody (3G10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...